Tesamorelin & Ipamorelin Blend (8mg)
$90.00
Tesamorelin & Ipamorelin blend is Synthesized and Lyophilized in the USA.
Tesamorelin & Ipamorelin Peptide Blend
The Tesamorelin and Ipamorelin peptide blend is a combination of peptide compounds investigated for their potential interaction with specific receptors in pituitary gland cells. These receptors include growth hormone secretagogue (GHS) receptors and growth hormone-releasing hormone (GHRH) receptors, both associated with the regulation of growth hormone (hGH) release.
Tesamorelin is a synthetic peptide proposed by researchers to function as a GHRH analog through binding to GHRH receptors.[1] It comprises a 44-amino acid chain containing a specific sequence structurally similar to GHRH. The peptide has additionally undergone structural modifications intended to support its resistance to enzymatic degradation. For example, the C-terminus of Tesamorelin has been modified with a trans-3-hexenoic acid group — an omega-amino acid modification hypothesized to enhance the peptide’s stability against enzymatic breakdown. An acetyl group (CH3CO-) has also been incorporated at the N-terminus, potentially improving the peptide’s stability and bioactivity. The compound is accordingly also designated N-(trans-3-hexenoyl)-[Tyr1]hGRF(1-44)NH2 acetate.[2] Through interaction with GHRH receptors in the pituitary and hypothalamus, Tesamorelin may promote hGH release from pituitary cells.
Ipamorelin is likewise a synthetic peptide proposed to interact with pituitary cells and potentially stimulate hGH synthesis and release. Its proposed mechanism of action involves engagement with GHS receptors — also referred to as ghrelin receptors — located in the pituitary and hypothalamus.[3] By activating these receptors, Ipamorelin may replicate aspects of ghrelin’s actions on the pituitary gland, potentially contributing to growth hormone secretion from pituitary cells.
Specifications
Tesamorelin Molecular Formula: C221H366N72O67S
Ipamorelin Molecular Formula: C38H49N9O5
Tesamorelin Molecular Weight: 5136 g/mol
Ipamorelin Molecular Weight: 711.868 g/mol
Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys
Tesamorelin & Ipamorelin Peptide Blend Research
Tesamorelin and Ipamorelin and the Pituitary Gland
Research suggests that Tesamorelin may interact with the pituitary gland by binding to GHRH receptors, potentially initiating a sequence of molecular events.[4] Should Tesamorelin engage the GHRH receptor, it may induce structural alterations in the receptor, activating intracellular signaling pathways.[5] Researchers noted that this binding process “is followed by a major conformational change that involves a large kink at the TM6 to open the intracellular face for G protein coupling.” One proposed pathway involves apparent stimulation of cyclic adenosine monophosphate (cAMP) production within pituitary cells, potentially achieved through activation of adenylate cyclase — the enzyme responsible for converting ATP to cAMP. Elevated cAMP levels are hypothesized to activate protein kinase A (PKA), an important intracellular signaling molecule that may phosphorylate various target proteins and initiate downstream cellular responses. This proposed GHRH receptor activation and subsequent cAMP-PKA signaling cascade may stimulate growth hormone synthesis and secretion from pituitary somatotrophs. Research indicates the peptide may induce a 69% rise in overall growth hormone levels as measured by area under the curve (AUC), alongside a possible 55% increase in average growth hormone pulse area — reflecting hormone release per pulse. The data nonetheless suggests the peptide does not appear to significantly influence pulse frequency or peak growth hormone concentrations.[6]
Ipamorelin, by contrast, appears to exhibit selectivity toward the GHS receptor without significant interaction with other receptors or meaningful influence on the release of other mediators such as adrenocorticotropic hormone (ACTH) and cortisol.[7] GHS receptor binding appears to activate various intracellular signaling pathways,[8] with one proposed route involving activation of phospholipase C (PLC), leading to release of inositol triphosphate (IP3) and diacylglycerol (DAG). IP3 may trigger calcium ion (Ca2+) release from intracellular stores while DAG may activate protein kinase C (PKC), with the resulting elevation in intracellular calcium and potential PKC activation contributing to exocytosis of growth hormone-containing vesicles from pituitary cells. Experimental findings suggest Ipamorelin may support growth hormone secretion to levels as high as 80 mIU/l — appearing to exceed placebo levels by more than 60-fold.[9]
Tesamorelin and Ipamorelin Blend and Fat Cells
Investigations into Tesamorelin indicate a potential reduction of approximately 25% in visceral fat in models simulating lipodystrophy — a condition characterized by abnormal fat distribution and storage often leading to visceral obesity, defined as excessive fat accumulation around and within internal organs. This has been tentatively associated with metabolic consequences including insulin resistance, elevated low-density lipoprotein (LDL) cholesterol, and hyperuricemia — an excessive buildup of uric acid. Tesamorelin may therefore potentially attenuate such metabolic consequences by increasing growth hormone production and thereby amplifying its fat-metabolizing actions, with particular affinity for visceral fat.[10]
Ipamorelin studies, conversely, suggest the peptide may cause modest increases in non-visceral fat accumulation despite its comparable growth hormone-stimulating effects — an outcome attributed to its appetite-stimulating and caloric intake-increasing actions. Ipamorelin’s interaction with ghrelin receptors, considered to play a central role in hunger regulation, may contribute to increased weight gain. One study reported a 15% increase in body weight in Ipamorelin-exposed research models during the observation period. Preliminary findings also suggest Ipamorelin may elevate serum leptin levels — a hormone involved in energy balance and appetite regulation — implying that increased food intake may contribute to the observed weight gain before rising leptin levels subsequently suppress appetite.[11]
Tesamorelin and Ipamorelin Blend and the Musculoskeletal System
One study analyzed the impact of Tesamorelin on muscle tissue quality,[12] employing computed tomography (CT) scans to measure muscle density and area before and after Tesamorelin or control compound introduction. Results suggested Tesamorelin may be associated with improvements in muscle density and area — particularly in muscle groups including the rectus abdominis, psoas major, and paraspinal muscles — reflected by increased muscle density and area or decreased intramuscular fat content. These changes were statistically significant relative to the placebo group. Notably, despite Tesamorelin being understood to act through mediators such as IGF-1, no significant correlation was observed between IGF-1 level changes and changes in muscle density or area.
Subsequent investigations into Ipamorelin suggest the compound may potentially support nitrogen balance restoration and reduce excessive nitrogen loss in the livers of rats subjected to catabolic stress. Studies assessed the liver’s capacity to synthesize urea-N as a potential indicator of hepatic nitrogen metabolism, examining mRNA concentrations for enzymes involved in the hepatic urea cycle and evaluating overall nitrogen management across the organism. Preliminary findings suggest Ipamorelin may produce an approximately 20% reduction in urea-N synthesis relative to artificially induced catabolic conditions, alongside a potential decrease in urea cycle enzyme activity — implying a tentative re-balancing of nitrogen and possible improvements in nitrogen distribution across tissues. These observations are tentatively linked to Ipamorelin’s proposed influence on hGH and, by extension, IGF-1 production.[13]
Tesamorelin and Ipamorelin Blend and Bone Mineral Density
Preliminary experimental studies suggest that Ipamorelin may exhibit effects resembling those observed with Tesamorelin on skeletal muscle and bone, though these findings have not been fully confirmed.[14] Specifically, Ipamorelin appeared to interact with and potentially elevate IGF-1 levels, with these effects associated with increased muscle fiber size, muscle mass, and enhanced skeletal muscle force in murine studies. Ipamorelin also appeared to exert a positive influence on bone tissue, potentially stimulating bone formation and promoting increased bone mass, with an apparent increase in bone mineral content also observed.
Additional murine studies have further suggested favorable Ipamorelin effects on bone tissue.[15,16] One investigation into bone mineral content (BMC) proposed a correlated increase in body weight and BMC as measured by dual X-ray absorptiometry (DXA), though when adjusted for body weight gain, the BMC-to-body weight ratio appeared to remain unaffected. In vitro analysis further suggested the increase in cortical BMC may have resulted from increased bone area rather than volumetric bone mineral density — with scientists noting that “the results of in vitro measurements using pQCT and Archimedes’ principle, in addition to ash weight determinations, show that the increases in cortical and total BMC were due to an increased growth of the bones with increased bone dimensions, whereas the volumetric BMD was unchanged.”
Tesamorelin and Ipamorelin Blend and Digestion
Research hypothesizes that Ipamorelin may activate the ghrelin receptor, believed to influence both appetite and digestive processes. A research team accordingly investigated Ipamorelin’s potential effects on various gastric functions — focusing particularly on its capacity to accelerate gastric emptying relative to a control compound. Models with experimentally induced delayed gastric emptying were employed, with the slowdown observed more frequently in the control group. Data indicated that Ipamorelin may facilitate more rapid gastric emptying compared to control, leading to the hypothesis that it may enhance the efficiency of this digestive process.
Further examination focused on Ipamorelin’s effects on gastric smooth muscle contractile behavior — considered critical for mechanical digestion. This component of the study assessed muscle responses to acetylcholine, a neurotransmitter involved in muscle contraction, and electrical field stimulation used to replicate nerve impulse-triggered muscle contraction. Preliminary findings suggested that certain intestinal interventions may significantly attenuate these muscular responses, though this attenuation appeared less pronounced when Ipamorelin was co-introduced with ghrelin — suggesting that Ipamorelin may not only support gastric muscle contractility but may also counteract adverse effects associated with specific interventions.[17]
Disclaimer: The products mentioned are not intended for human or animal consumption. Research chemicals are intended solely for laboratory experimentation and/or in-vitro testing. Bodily introduction of any sort is strictly prohibited by law. All purchases are limited to licensed researchers and/or qualified professionals. All information shared in this article is for educational purposes only.
References
- Clinical Review Report: Tesamorelin (Egrifta) [Internet]. Ottawa (ON): Canadian Agency for Drugs and Technologies in Health; 2016 Aug. 1, Introduction. Available from: https://www.ncbi.nlm.nih.gov/books/NBK539137/
- Ferdinandi, E. S., Brazeau, P., High, K., Procter, B., Fennell, S., & Dubreuil, P. (2007). Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. Basic & clinical pharmacology & toxicology, 100(1), 49–58. https://doi.org/10.1111/j.1742-7843.2007.00008.x
- Johansen, P. B., Nowak, J., Skjaerbaek, C., Flyvbjerg, A., Andreassen, T. T., Wilken, M., & Orskov, H. (1999). Ipamorelin, a new growth-hormone-releasing peptide, induces longitudinal bone growth in rats. Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society, 9(2), 106–113. https://doi.org/10.1054/ghir.1999.9998
- Spooner, L. M., & Olin, J. L. (2012). Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy. The Annals of pharmacotherapy, 46(2), 240–247. https://doi.org/10.1345/aph.1Q629
- Zhou, F., Zhang, H., Cong, Z., Zhao, L. H., Zhou, Q., Mao, C., Cheng, X., Shen, D. D., Cai, X., Ma, C., Wang, Y., Dai, A., Zhou, Y., Sun, W., Zhao, F., Zhao, S., Jiang, H., Jiang, Y., Yang, D., Eric Xu, H., … Wang, M. W. (2020). Structural basis for activation of the growth hormone-releasing hormone receptor. Nature communications, 11(1), 5205. https://doi.org/10.1038/s41467-020-18945-0
- Stanley TL, Chen CY, Branch KL, Makimura H, Grinspoon SK. Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men. J Clin Endocrinol Metab. 2011 Jan;96(1):150-8. doi: 10.1210/jc.2010-1587. Epub 2010 Oct 13. PMID: 20943777; PMCID: PMC3038486. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3038486/
- Raun, K., Hansen, B. S., Johansen, N. L., Thøgersen, H., Madsen, K., Ankersen, M., & Andersen, P. H. (1998). Ipamorelin, the first selective growth hormone secretagogue. European journal of endocrinology, 139(5), 552–561. https://doi.org/10.1530/eje.0.1390552
- Jiménez-Reina, L., Cañete, R., de la Torre, M. J., & Bernal, G. (2002). Influence of chronic treatment with the growth hormone secretagogue Ipamorelin, in young female rats: somatotroph response in vitro. Histology and histopathology, 17(3), 707–714. https://doi.org/10.14670/HH-17.707
- Gobburu, J. V., Agersø, H., Jusko, W. J., & Ynddal, L. (1999). Pharmacokinetic-pharmacodynamic modeling of ipamorelin, a growth hormone releasing peptide, in human volunteers. Pharmaceutical research, 16(9), 1412–1416. https://doi.org/10.1023/a:1018955126402
- Sivakumar T, Mechanic O, Fehmie DA, Paul B. Growth hormone axis treatments for HIV-associated lipodystrophy: a systematic review of placebo-controlled trials. HIV Med. 2011 Sep;12(8):453-62. doi: 10.1111/j.1468-1293.2010.00906.x. Epub 2011 Jan 25. PMID: 21265979.
- Lall, S., Tung, L. Y., Ohlsson, C., Jansson, J. O., & Dickson, S. L. (2001). Growth hormone (GH)-independent stimulation of adiposity by GH secretagogues. Biochemical and biophysical research communications, 280(1), 132–138. https://doi.org/10.1006/bbrc.2000.4065
- Adrian, S., Scherzinger, A., Sanyal, A., Lake, J. E., Falutz, J., Dubé, M. P., Stanley, T., Grinspoon, S., Mamputu, J. C., Marsolais, C., Brown, T. T., & Erlandson, K. M. (2019). The Growth Hormone Releasing Hormone Analogue, Tesamorelin, Decreases Muscle Fat and Increases Muscle Area in Adults with HIV. The Journal of frailty & aging, 8(3), 154–159. https://doi.org/10.14283/jfa.2018.45
- Andersen, N. B., Malmlöf, K., Johansen, P. B., Andreassen, T. T., Ørtoft, G., & Oxlund, H. (2001). The growth hormone secretagogue ipamorelin counteracts glucocorticoid-induced decrease in bone formation of adult rats. Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society, 11(5), 266–272. https://doi.org/10.1054/ghir.2001.0239
- Aagaard, N. K., Grøfte, T., Greisen, J., Malmlöf, K., Johansen, P. B., Grønbaek, H., Ørskov, H., Tygstrup, N., & Vilstrup, H. (2009). Growth hormone and growth hormone secretagogue effects on nitrogen balance and urea synthesis in steroid treated rats. Growth hormone & IGF research: official journal of the Growth Hormone Research Society and the International IGF Research Society, 19(5), 426–431. https://doi.org/10.1016/j.ghir.2009.01.001
- Johansen, P. B., Nowak, J., Skjaerbaek, C., Flyvbjerg, A., Andreassen, T. T., Wilken, M., & Orskov, H. (1999). Ipamorelin, a new growth-hormone-releasing peptide, induces longitudinal bone growth in rats. Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society, 9(2), 106–113. https://doi.org/10.1054/ghir.1999.9998
- Svensson, J., Lall, S., Dickson, S. L., Bengtsson, B. A., Rømer, J., Ahnfelt-Rønne, I., Ohlsson, C., & Jansson, J. O. (2000). The GH secretagogues ipamorelin and GH-releasing peptide-6 increase bone mineral content in adult female rats. The Journal of endocrinology, 165(3), 569–577. https://doi.org/10.1677/joe.0.1650569

Reviews
There are no reviews yet.